|
Antibody HPA048341
|
|
Antibody HPA049988
|
|
Antibody HPA055992
|
|
Antibody CAB018772
|
|
Antibody CAB036006
|
|
Antibody CAB036007
|
|
ANTIBODY INFORMATION
|
|
Provider |
Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| | Santa Cruz Biotechnology
| | NCI-CPTC
| | NCI-CPTC
| |
Product name |
HPA048341 | | HPA049988 | | HPA055992 | | sc-28384 | | CPTC-SERPINB3-1 | | 628A74 | |
Host species |
Rabbit | | Rabbit | | Rabbit | | Mouse | | Mouse | | Mouse | |
Clonality |
pAb | | pAb | | pAb | | mAb | | mAb | | mAb | |
Purity |
Affinity purified using the PrEST-antigen as affinity ligand | | Affinity purified using the PrEST-antigen as affinity ligand | | Affinity purified using the PrEST-antigen as affinity ligand | | Protein A/G | | Protein A/G | | Protein A/G | |
Released in version |
12 | | 13 | | 13 | | 4 | | 7 | | 13 | |
ANTIGEN INFORMATION
|
|
Antigen |
Recombinant protein fragment | | Recombinant protein fragment | | Recombinant protein fragment | | Not known | | Recombinant protein | | Recombinant protein | |
Length (aa) |
31 | | 29 | | 48 | | | | | | | |
Antigen sequence |
QEYLDAIKKFYQTSVESTDFANAPEESRKKI
| | KLEEKLTAEKLMEWTSLQNMRETCVDLHL
| | KVLHFDQVTENTTEKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELK
| |
| |
| |
| |
Matching transcripts |
SERPINB3-001 - ENSP00000283752 [97%] SERPINB3-002 - ENSP00000329498 [97%]
| | SERPINB3-001 - ENSP00000283752 [97%] SERPINB3-002 - ENSP00000329498 [97%]
| | SERPINB3-001 - ENSP00000283752 [98%] SERPINB3-002 - ENSP00000329498 [98%]
| | | | | | | |
Other gene match |
SERPINB4 - ENSG00000206073 [100%]
| | SERPINB4 - ENSG00000206073 [100%]
| | SERPINB4 - ENSG00000206073 [100%]
| | | | | | | |
ANTIBODY VALIDATION
|
|
Immunohistochemistry
|
|
Image |
| | | | | | | | | | | |
Description |
Immunohistochemical staining of human vagina shows moderate cytoplasmic and nuclear positivity in squamous epithelial cells. More information | | Immunohistochemical staining of human vulva/anal skin shows moderate cytoplasmic and nuclear positivity in epidermal cells. More information | | Immunohistochemical staining of human vagina shows strong cytoplasmic and nuclear positivity in squamous epithelial cells. More information | | Immunohistochemical staining of human esophagus shows strong cytoplasmic positivity as well as a few positive nuclei in squamous epithelial cells. More information | | Application not done for this antibody. | | Immunohistochemical staining of human cervix, uterine shows strong nuclear and cytoplasmic positivity in squamous epithelial cells. More information | |
Retrieval method |
HIER pH6 | | HIER pH6 | | HIER pH6 | | HIER pH6 | | | | HIER pH6 | |
Antibody dilution |
1:1800 | | 1:250 | | 1:175 | | 1:50 | | | | 1:250 | |
Literature conformity |
Consistent with extensive gene/protein characterization data | | Partly consistent with extensive gene/protein characterization data | | Consistent with extensive gene/protein characterization data | | Consistent with extensive gene/protein characterization data | | | | Consistent with extensive gene/protein characterization data | |
RNA consistency |
Mainly consistent with RNAseq data | | Mainly consistent with RNAseq data | | Not done | | Consistent with RNAseq data | | | | Consistent with RNAseq data | |
Western Blot
|
|
Image |
| | | | | | | | | | | |
Description |
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | | | Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | | | Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | |
Target mass (kDa) |
44.9, 44.6, 42.4, 38.8, 38.5, 24.4 | | 44.9, 44.6, 42.4, 38.8, 38.5 | | 44.9, 44.6, 42.4, 38.8, 38.5 | | 44.6, 38.5 | | 44.6, 38.5 | | 44.6, 38.5 | |
Antibody dilution |
1:250 | | 1:220 | | 1:120 | | 1:500 | | 1:500 | | 1:500 | |
Validation WB |
Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data | | Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data | | Non-supportive: Only bands not corresponding to the predicted size | | Uncertain: No bands detected | | Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present | | Supportive: Single band corresponding to the predicted size in kDa (+/-20%) | |
Immunofluorescence
|
|
Image |
| | | | | | | | | | | |
Description |
Application not done for this antibody. | | Application not done for this antibody. | | Application not done for this antibody. | | Application not done for this antibody. | | Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane & cytoplasm. More information | | Application not done for this antibody. | |
Antibody dilution |
| | | | | | | | 1:20 | | | |
Validation IF |
| | | | | | | | Supportive: The subcellular location is supported by literature. | | | |
Protein array
|
|
Image |
| | | | | | | | | | | |
Description |
Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Application not done for this antibody. | | Application not done for this antibody. | | Application not done for this antibody. | |
Antibody dilution |
1:2000 | | 1:1750 | | 1:650 | | | | | | | |
Validation PA |
Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). | | Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). | | Supportive: Pass with single peak corresponding to interaction only with its own antigen. | | | | | | | |
|