|
Antibody HPA001042
|
|
Antibody HPA029543
|
|
Antibody CAB023669
|
|
Antibody CAB062562
|
|
Antibody CAB067751
|
|
Antibody CAB068229
|
|
Antibody CAB068230
|
|
Antibody CAB068231
|
|
Antibody CAB072767
|
|
ANTIBODY INFORMATION
|
|
Provider |
Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| | Santa Cruz Biotechnology
| | Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| |
Product name |
HPA001042 | | HPA029543 | | sc-81376 | | AMAb90635 | | AMAb90679 | | AMAb90678 | | AMAb90680 | | AMAb90682 | | AMAb90679 | |
Host species |
Rabbit | | Rabbit | | Mouse | | Mouse | | Mouse | | Mouse | | Mouse | | Mouse | | Mouse | |
Clonality |
pAb | | pAb | | mAb | | mAb | | mAb | | mAb | | mAb | | mAb | | mAb | |
Purity |
Affinity purified using the PrEST-antigen as affinity ligand | | Affinity purified using the PrEST-antigen as affinity ligand | | Protein A/G | | Protein A/G | | Protein A/G | | Protein A/G | | Protein A/G | | Protein A/G | | Not known | |
Released in version |
6 | | 9 | | 9 | | 12 | | 13 | | 13 | | 13 | | 13 | | 13 | |
ANTIGEN INFORMATION
|
|
Antigen |
Recombinant protein fragment | | Recombinant protein fragment | | Recombinant protein | | Recombinant protein | | Recombinant protein | | Recombinant protein | | Recombinant protein | | Recombinant protein | | Recombinant protein | |
Length (aa) |
123 | | 115 | | | | | | | | | | | | | | | |
Antigen sequence |
VSQAVFARVAFNRTQGLLSEILRKEEDPRTASQSLLVNLRAMQNFLNLPE
VERDRIYQDERERSMNPNVSMVSSASSSPSSSRTPQAKTSTPTTDLPIKV
DGANINITAAIYDEIQQEMKRAK
| | KECPLSQSMISSIVNSTYYANVSATKCQEFGRWYKKYKKIKVERVERENL
SDYCVLGQRPMHLPNMNQLASLGKTNEQSPHSQIHHSTPIRNQVPALQPI
MSPGLLSPQLSPQLV
| |
| |
| |
| |
| |
| |
| |
| |
Matching transcripts |
SATB2-001 - ENSP00000401112 [100%] SATB2-002 - ENSP00000405420 [100%] SATB2-003 - ENSP00000260926 [100%] SATB2-012 - ENSP00000388764 [100%] SATB2-013 - ENSP00000388581 [100%]
| | SATB2-001 - ENSP00000401112 [100%] SATB2-002 - ENSP00000405420 [100%] SATB2-003 - ENSP00000260926 [100%] SATB2-012 - ENSP00000388764 [100%]
| | | | | | | | | | | | | | | |
Other gene match |
| | | | | | | | | | | | | | | | | |
ANTIBODY VALIDATION
|
|
Immunohistochemistry
|
|
Image |
| | | | | | | | | | | | | | | | | |
Description |
Immunohistochemical staining of human rectum shows strong nuclear positivity in glandular cells. More information | | Immunohistochemical staining of human rectum shows strong nuclear positivity in glandular cells. More information | | Immunohistochemical staining of human rectum shows strong nuclear positivity in glandular cells. More information | | Immunohistochemical staining of human colon shows distinct nuclear positivity in glandular cells. More information | | Immunohistochemical staining of human rectum shows strong nuclear positivity in glandular cells. More information | | Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells. More information | | Immunohistochemical staining of human rectum shows strong nuclear positivity in glandular cells. More information | | Immunohistochemical staining of human rectum shows strong nuclear positivity in glandular cells. More information | | Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells. More information | |
Retrieval method |
HIER pH6 | | HIER pH6 | | HIER pH6 | | HIER pH6 | | HIER pH6 | | HIER pH6 | | HIER pH6 | | HIER pH6 | | HIER pH6 | |
Antibody dilution |
1:50 | | 1:500 | | 1:100 | | 1:300 | | 1:1000 | | 1:500 | | 1:250 | | 1:1000 | | 1:500 | |
Literature conformity |
Consistent with extensive gene/protein characterization data | | Consistent with extensive gene/protein characterization data | | Consistent with extensive gene/protein characterization data | | Consistent with extensive gene/protein characterization data | | Consistent with extensive gene/protein characterization data | | Consistent with extensive gene/protein characterization data | | Consistent with extensive gene/protein characterization data | | Consistent with extensive gene/protein characterization data | | Consistent with extensive gene/protein characterization data | |
RNA consistency |
Not done | | Consistent with RNAseq data | | Not done | | Consistent with RNAseq data | | Consistent with RNAseq data | | Consistent with RNAseq data | | Consistent with RNAseq data | | Consistent with RNAseq data | | Consistent with RNAseq data | |
Immunofluorescence
|
|
Image |
| | | | | | | | | | | | | | | | | |
Description |
Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm & nucleus but excluded from the nucleoli. More information | | Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli. More information | | Application not done for this antibody. | | Application not done for this antibody. | | Application not done for this antibody. | | Application not done for this antibody. | | Application not done for this antibody. | | Application not done for this antibody. | | Application not done for this antibody. | |
Antibody dilution |
1:25 | | 1:20 | | | | | | | | | | | | | | | |
Validation IF |
Supportive: The subcellular location is supported by literature. | | Supportive: The subcellular location is supported by literature. | | | | | | | | | | | | | | | |
Western Blot
|
|
Image |
| | | | | | | | | | | | | | | | | |
Description |
Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5 Lane 2: RT4 Lane 3: EFO-21 Lane 4: A-431 Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | | | Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | |
Target mass (kDa) |
82.6, 76, 69.1 | | 82.6, 76 | | 82.6, 76, 69.1, 13.6 | | 82.6, 76, 69.1, 13.6 | | 82.6, 76, 69.1, 13.6 | | 82.6, 76, 69.1, 13.6 | | 82.6, 76, 69.1, 13.6 | | 82.6, 76, 69.1, 13.6 | | 82.6, 76, 69.1, 13.6 | |
Antibody dilution |
1:500 | | 1:250 | | 1:500 | | 1:500 | | 1:1000 | | 1:1000 | | 1:1000 | | 1:1000 | | 1:1000 | |
Validation WB |
Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data | | Uncertain: No bands detected | | Supportive: Single band corresponding to the predicted size in kDa (+/-20%) | | Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present | | Uncertain: No bands detected | | Uncertain: No bands detected | | Uncertain: No bands detected | | Supportive: Single band corresponding to the predicted size in kDa (+/-20%) | | Uncertain: No bands detected | |
Protein array
|
|
Image |
| | | | | | | | | | | | | | | | | |
Description |
Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Application not done for this antibody. | | Application not done for this antibody. | | Application not done for this antibody. | | Application not done for this antibody. | | Application not done for this antibody. | | Application not done for this antibody. | | Application not done for this antibody. | |
Antibody dilution |
1:2000 | | 1:500 | | | | | | | | | | | | | | | |
Validation PA |
Supportive: Pass with single peak corresponding to interaction only with its own antigen. | | Supportive: Pass with single peak corresponding to interaction only with its own antigen. | | | | | | | | | | | | | | | |
|