|
Antibody HPA005680
|
|
Antibody HPA050556
|
|
Antibody CAB033902
|
|
Antibody CAB062547
|
|
Antibody CAB068175
|
|
ANTIBODY INFORMATION
|
|
Provider |
Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| | Santa Cruz Biotechnology
| | Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| |
Product name |
HPA005680 | | HPA050556 | | sc-67327 | | AMAb90660 | | AMAb90662 | |
Host species |
Rabbit | | Rabbit | | Rabbit | | Mouse | | Mouse | |
Clonality |
pAb | | pAb | | pAb | | mAb | | mAb | |
Purity |
Affinity purified using the PrEST-antigen as affinity ligand | | Affinity purified using the PrEST-antigen as affinity ligand | | Protein A/G | | Protein A/G | | Protein A/G | |
Released in version |
12 | | 13 | | 13 | | 12 | | 13 | |
ANTIGEN INFORMATION
|
|
Antigen |
Recombinant protein fragment | | Recombinant protein fragment | | Recombinant protein | | Recombinant protein | | Recombinant protein | |
Length (aa) |
136 | | 133 | | | | | | | |
Antigen sequence |
IVKSTLSQTVPSKGELSREICLQSQSKDKSTTPGGTGIKPFLERFGERCQ
EHSKESPARSTPHRTPIITPNTKAIQERLFKQDTSSSTTHLAQQLKQERQ
KELACLRGRFDKGNIWSAEKGGNSKSKQLETKQETH
| | DLFSDVLEEGELDMEKSQEEMDQALAESSEEQEDALNISSMSLLAPLAQT
VGVVSPESLVSTPRLELKDTSRSDESPKPGKFQRTRVPRAESGDSLGSED
RDLLYSIDAYRSQRFKETERPSIKQVIVRKEDV
| |
| |
| |
| |
Matching transcripts |
ANLN-001 - ENSP00000265748 [100%] ANLN-002 - ENSP00000379380 [100%]
| | ANLN-001 - ENSP00000265748 [100%] ANLN-002 - ENSP00000379380 [100%]
| | | | | | | |
Other gene match |
| | | | | | | | | |
ANTIBODY VALIDATION
|
|
Immunohistochemistry
|
|
Image |
| | | | | | | | | |
Description |
Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts. More information | | Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts. More information | | Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts. More information | | Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts. More information | | Immunohistochemical staining of human duodenum shows nuclear positivity in glandular cells. More information | |
Retrieval method |
HIER pH6 | | HIER pH6 | | HIER pH6 | | HIER pH6 | | HIER pH6 | |
Antibody dilution |
1:100 | | 1:450 | | 1:125 | | 1:100 | | 1:100 | |
Literature conformity |
Consistent with extensive gene/protein characterization data | | Partly consistent with extensive gene/protein characterization data | | Partly consistent with extensive gene/protein characterization data | | Consistent with extensive gene/protein characterization data | | Partly consistent with extensive gene/protein characterization data | |
RNA consistency |
Mainly consistent with RNAseq data | | Mainly consistent with RNAseq data | | Mainly not consistent with RNAseq data | | Mainly not consistent with RNAseq data | | Mainly consistent with RNAseq data | |
Immunofluorescence
|
|
Image |
| | | | | | | | | |
Description |
Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli. More information | | Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli. More information | | Application not done for this antibody. | | Application not done for this antibody. | | Application not done for this antibody. | |
Antibody dilution |
1:71 | | 1:60 | | | | | | | |
Validation IF |
Supportive: The subcellular location is supported by literature. | | Supportive: The subcellular location is supported by literature. | | | | | | | |
Western Blot
|
|
Image |
| | | | | | | | | |
Description |
Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | | | Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | |
Target mass (kDa) |
124.2, 120 | | 124.2, 120 | | 124.2, 120, 30.8, 27.8, 26.6, 18.2, 7.8, 7.2, 3.8, 2.8 | | 124.2, 120, 30.8, 27.8, 26.6, 18.2, 7.8, 7.2, 3.8, 2.8 | | 124.2, 120, 30.8, 27.8, 26.6, 18.2, 7.8, 7.2, 3.8, 2.8 | |
Antibody dilution |
1:250 | | 1:300 | | 1:500 | | 1:500 | | 1:1000 | |
Validation WB |
Supportive: Band of predicted size in kDa (+/-20%) with additional bands present | | Supportive: Band of predicted size in kDa (+/-20%) with additional bands present | | Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present | | Supportive: Band of predicted size in kDa (+/-20%) with additional bands present | | Supportive: Band of predicted size in kDa (+/-20%) with additional bands present | |
Protein array
|
|
Image |
| | | | | | | | | |
Description |
Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Application not done for this antibody. | | Application not done for this antibody. | | Application not done for this antibody. | |
Antibody dilution |
1:1000 | | 1:2400 | | | | | | | |
Validation PA |
Supportive: Pass with single peak corresponding to interaction only with its own antigen. | | Supportive: Pass with single peak corresponding to interaction only with its own antigen. | | | | | | | |
|