|
Antibody HPA018402
|
|
Antibody HPA023959
|
|
Antibody HPA029909
|
|
Antibody HPA029910
|
|
Antibody CAB012357
|
|
ANTIBODY INFORMATION
|
|
Provider |
Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| | Abcam plc
| |
Product name |
HPA018402 | | HPA023959 | | HPA029909 | | HPA029910 | | 31351 | |
Host species |
Rabbit | | Rabbit | | Rabbit | | Rabbit | | Rabbit | |
Clonality |
pAb | | pAb | | pAb | | pAb | | msAb | |
Purity |
Affinity purified using the PrEST-antigen as affinity ligand | | Affinity purified using the PrEST-antigen as affinity ligand | | Affinity purified using the PrEST-antigen as affinity ligand | | Affinity purified using the PrEST-antigen as affinity ligand | | Affinity | |
Released in version |
4 | | 5 | | 6 | | 6 | | 4 | |
ANTIGEN INFORMATION
|
|
Antigen |
Recombinant protein fragment | | Recombinant protein fragment | | Recombinant protein fragment | | Recombinant protein fragment | | Synthetic peptide | |
Length (aa) |
130 | | 81 | | 127 | | 125 | | | |
Antigen sequence |
ILGPLFTYLHMRLSQKWQVINQRSLLCGEDEAADENPESQEMLEEQLVRM
LTREVMDLITVCCVSKKGADHSSAPPADGDDEEMMATEVTPSAMAELTDL
GKCLMKHEDVCTALLITAFNSLAWKDTLSC
| | ASLVHLAFQIYEALRPRYLEIRAVMEQIPEIQKDSLDQFDCKLLNPSLQK
VADKRRKDQFKRLIAGCIGKPLGEQFRKEVH
| | MSFCVYSILGVVKRTCWPTDLEEAKAGGFVVGYTSSGNPIFRNPCTEQIL
KLLDNLLALIRTHNTLYAPEMLAKMAEPFTKALDMLDAEKSAILGLPQPL
LELNDSPVFKTVLERMQRFFSTLYENC
| | AGEWLKYQLSTFLDAGSVNSCSAVGTGEGSLCSVFSPSFVQWEAMTLFLE
SVITQMFRTLNREEIPVNDGIELLQMVLNFDTKDPLILSCVLTNVSALFP
FVTYRPEFLPQVFSKLFSSVTFETV
| |
| |
Matching transcripts |
XPO5-001 - ENSP00000265351 [100%] XPO5-015 - ENSP00000387384 [92%]
| | XPO5-001 - ENSP00000265351 [100%]
| | XPO5-001 - ENSP00000265351 [100%]
| | XPO5-001 - ENSP00000265351 [100%]
| | | |
Other gene match |
| | | | | | | | | |
ANTIBODY VALIDATION
|
|
Immunohistochemistry
|
|
Image |
| | | | | | | | | |
Description |
Immunohistochemical staining of human testis shows strong positivity in seminiferus ducts. More information | | Immunohistochemical staining of human testis shows distinct nuclear and cytoplasmic positivity in germ cells. More information | | Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in subsets of cells outside the germinal center. More information | | Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes. More information | | Immunohistochemical staining of human kidney shows granular cytoplasmic positivity in cells in tubules. More information | |
Retrieval method |
HIER pH6 | | HIER pH6 | | HIER pH6 | | HIER pH6 | | HIER pH6 | |
Antibody dilution |
1:250 | | 1:50 | | 1:250 | | 1:35 | | 1:100 | |
Literature conformity |
Consistent with extensive gene/protein characterization data | | Consistent with extensive gene/protein characterization data | | Consistent with extensive gene/protein characterization data | | Consistent with extensive gene/protein characterization data | | Consistent with extensive gene/protein characterization data | |
RNA consistency |
Not done | | Not done | | Not done | | Not done | | Not done | |
Immunofluorescence
|
|
Image |
| | | | | | | | | |
Description |
Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli. More information | | Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli. More information | | Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli. More information | | Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli. More information | | Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm & nucleus but excluded from the nucleoli. More information | |
Antibody dilution |
1:54 | | 1:50 | | 1:50 | | 1:20 | | 1:25 | |
Validation IF |
Supportive: The subcellular location is supported by literature. | | Supportive: The subcellular location is supported by literature. | | Supportive: The subcellular location is supported by literature. | | Supportive: The subcellular location is supported by literature. | | Supportive: The subcellular location is supported by literature. | |
Western Blot
|
|
Image |
| | | | | | | | | |
Description |
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 219, 111, 83, 48, 32, 26, 17 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | |
Target mass (kDa) |
136.3, 28.3 | | 136.3 | | 136.3 | | 136.3 | | 136.3, 28.3, 12.1, 8.7, 7, 2.4 | |
Antibody dilution |
1:250 | | 1:250 | | 1:250 | | 1:250 | | 1:500 | |
Validation WB |
Supportive: Band of predicted size in kDa (+/-20%) with additional bands present | | Supportive: Single band corresponding to the predicted size in kDa (+/-20%) | | Supportive: Band of predicted size in kDa (+/-20%) with additional bands present | | Uncertain: No bands detected | | Supportive: Band of predicted size in kDa (+/-20%) with additional bands present | |
siRNA
|
|
Image |
| | | | | | | | | |
Description |
Signal downregulation > 25% by one siRNA. More information | | Application not done for this antibody. | | Application not done for this antibody. | | Application not done for this antibody. | | Application not done for this antibody. | |
Antibody dilution |
1:55 | | | | | | | | | |
Validation siRNA |
Supportive: The siRNA validation is supportive. | | | | | | | | | |
Protein array
|
|
Image |
| | | | | | | | | |
Description |
Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Application not done for this antibody. | |
Antibody dilution |
1:3000 | | 1:3000 | | 1:3000 | | 1:3000 | | | |
Validation PA |
Supportive: Pass with single peak corresponding to interaction only with its own antigen. | | Supportive: Pass with single peak corresponding to interaction only with its own antigen. | | Supportive: Pass with single peak corresponding to interaction only with its own antigen. | | Supportive: Pass with single peak corresponding to interaction only with its own antigen. | | | |
|