|
Antibody HPA013568
|
|
Antibody HPA015535
|
|
Antibody HPA043136
|
|
Antibody HPA047029
|
|
Antibody HPA047052
|
|
ANTIBODY INFORMATION
|
|
Provider |
Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| |
Product name |
HPA013568 | | HPA015535 | | HPA043136 | | HPA047029 | | HPA047052 | |
Host species |
Rabbit | | Rabbit | | Rabbit | | Rabbit | | Rabbit | |
Clonality |
pAb | | pAb | | pAb | | pAb | | pAb | |
Purity |
Affinity purified using the PrEST-antigen as affinity ligand | | Affinity purified using the PrEST-antigen as affinity ligand | | Affinity purified using the PrEST-antigen as affinity ligand | | Affinity purified using the PrEST-antigen as affinity ligand | | Affinity purified using the PrEST-antigen as affinity ligand | |
Released in version |
13 | | 4 | | 13 | | 13 | | 13 | |
ANTIGEN INFORMATION
|
|
Antigen |
Recombinant protein fragment | | Recombinant protein fragment | | Recombinant protein fragment | | Recombinant protein fragment | | Recombinant protein fragment | |
Length (aa) |
53 | | 117 | | 71 | | 80 | | 79 | |
Antigen sequence |
KEQQEEKSGLFRNMGRNEDGERRAMITPALREALTKQVDAPRERSLLQTH
ILW
| | RRAMITPALREALTKQGYQLIGSHSGVKLCRWTKSMLRGRGGCYKHTFYG
IESHRCMETTPSLACANKCVFCWRHHTNPVGTEWRWKMDQPEMILKEAIE
NHQNMIKQFKGVPGVKA
| | QCKISSFLVTNAQFPAEIRNLEPVTQLYVSVDASTKDSLKKIDRPLFKDF
WQQFLDSLKALAVKQQRTVYR
| | RELVDLIPEYEIACEHEHSNCLLIAHRKFKIGGEWWTWIDYNRFQELIQE
YEDSGGSKTFSAKDYMARTPHWALFGANER
| | RVMSRGEGDCDVVKSKHGSIEANFRAWKTKFISQLQALQKGERKKSCGGH
CKKGKCESHQHGSEEREEGSQEQDELHHR
| |
Matching transcripts |
TYW1-002 - ENSP00000354795 [96%]
| | TYW1-001 - ENSP00000352645 [100%]
| | TYW1-001 - ENSP00000352645 [99%]
| | TYW1-001 - ENSP00000352645 [98%]
| | TYW1-001 - ENSP00000352645 [97%] TYW1-002 - ENSP00000354795 [97%]
| |
Other gene match |
| | | | | | | | | |
ANTIBODY VALIDATION
|
|
Immunohistochemistry
|
|
Image |
| | | | | | | | | |
Description |
Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes. More information | | Immunohistochemical staining of human adrenal gland shows strong membranous positivity in cortical cells. More information | | Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts. More information | | Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells. More information | | Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells. More information | |
Retrieval method |
HIER pH6 | | HIER pH6 | | HIER pH6 | | HIER pH6 | | HIER pH6 | |
Antibody dilution |
1:65 | | 1:25 | | 1:10 | | 1:35 | | 1:50 | |
Literature conformity |
No avaliable characterization data | | No avaliable characterization data | | No avaliable characterization data | | No avaliable characterization data | | No avaliable characterization data | |
RNA consistency |
Mainly not consistent with RNAseq data | | Mainly not consistent with RNAseq data | | Not done | | Mainly not consistent with RNAseq data | | Mainly not consistent with RNAseq data | |
Western Blot
|
|
Image |
| | | | | | | | | |
Description |
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | |
Target mass (kDa) |
43.7 | | 83.7 | | 83.7 | | 83.7 | | 83.7, 43.7 | |
Antibody dilution |
1:250 | | 1:250 | | 1:250 | | 1:180 | | 1:210 | |
Validation WB |
Supportive: Band of predicted size in kDa (+/-20%) with additional bands present | | Supportive: Band of predicted size in kDa (+/-20%) with additional bands present | | Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data | | Uncertain: No bands detected | | Supportive: Single band corresponding to the predicted size in kDa (+/-20%) | |
Protein array
|
|
Image |
| | | | | | | | | |
Description |
Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | |
Antibody dilution |
1:3000 | | 1:3000 | | 1:3000 | | 1:1450 | | 1:1650 | |
Validation PA |
Supportive: Pass with single peak corresponding to interaction only with its own antigen. | | Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). | | Supportive: Pass with single peak corresponding to interaction only with its own antigen. | | Supportive: Pass with single peak corresponding to interaction only with its own antigen. | | Supportive: Pass with single peak corresponding to interaction only with its own antigen. | |
Immunofluorescence
|
|
Image |
| | | | | | | | | |
Description |
Application not done for this antibody. | | Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli. More information | | Application not done for this antibody. | | Application not done for this antibody. | | Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm & nucleus but excluded from the nucleoli. More information | |
Antibody dilution |
| | 1:25 | | | | | | 1:42 | |
Validation IF |
| | Supportive: The subcellular location is supported by literature. | | | | | | Supportive: The subcellular location is supported by literature. | |
|