NBPF24

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA038748

 

Antibody HPA038752

 

Antibody HPA042595

 

Antibody HPA043105

 

Antibody HPA044023

 

Antibody HPA046971

 

Antibody HPA058050

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA038748 HPA038752 HPA042595 HPA043105 HPA044023 HPA046971 HPA058050 

Host species

Rabbit Rabbit Rabbit Rabbit Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb pAb pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

13 13 13 13 13 13 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

25 25 25 25 29 30 25 

Antigen sequence

EEDKVNSSLVVDRESSHDGCQDALN
 
MFSNSTGRLPGQPTEEIQQYKVLVH
 
GPVSPRNLQESEEEEVPQESWDEGY
 
SGCLELTDSCQPYRSAFYVLEQQRV
 
VDIGRHRWDQVKKEDQEATGPRLSRELLD
 
RELLDEKEPEVLQDSLDRCYSTPSGYLELP
 
MVVSAGPLSSEKAEMNILEINEKLR
 

Matching transcripts

NBPF24-001 - ENSP00000358228 [100%]
NBPF24-002 - ENSP00000464250 [100%]
NBPF24-003 - ENSP00000462777 [100%]
NBPF24-008 - ENSP00000358230 [100%]
 NBPF24-001 - ENSP00000358228 [96%]
NBPF24-002 - ENSP00000464250 [96%]
 NBPF24-001 - ENSP00000358228 [100%]
NBPF24-002 - ENSP00000464250 [100%]
NBPF24-003 - ENSP00000462777 [100%]
NBPF24-008 - ENSP00000358230 [100%]
 NBPF24-001 - ENSP00000358228 [80%]
NBPF24-008 - ENSP00000358230 [80%]
 NBPF24-001 - ENSP00000358228 [100%]
NBPF24-008 - ENSP00000358230 [100%]
 NBPF24-001 - ENSP00000358228 [97%]
NBPF24-008 - ENSP00000358230 [97%]
 NBPF24-001 - ENSP00000358228 [96%]
NBPF24-002 - ENSP00000464250 [96%]
NBPF24-003 - ENSP00000462777 [96%]
NBPF24-008 - ENSP00000358230 [96%]
 

Other gene match

NBPF11 - ENSG00000152042 [100%]
NBPF10 - ENSG00000163386 [88%]
NBPF12 - ENSG00000186275 [92%]
NBPF20 - ENSG00000203832 [88%]
NBPF1 - ENSG00000219481 [88%]
 NBPF11 - ENSG00000152042 [100%]
NBPF12 - ENSG00000186275 [100%]
NBPF20 - ENSG00000203832 [92%]
 NBPF14 - ENSG00000122497 [100%]
NBPF3 - ENSG00000142794 [92%]
NBPF11 - ENSG00000152042 [100%]
NBPF8 - ENSG00000162825 [100%]
NBPF10 - ENSG00000163386 [100%]
NBPF9 - ENSG00000168614 [100%]
NBPF12 - ENSG00000186275 [100%]
NBPF16 - ENSG00000203827 [100%]
NBPF20 - ENSG00000203832 [100%]
NBPF1 - ENSG00000219481 [100%]
NBPF15 - ENSG00000243452 [100%]
 NBPF14 - ENSG00000122497 [100%]
NBPF11 - ENSG00000152042 [80%]
NBPF8 - ENSG00000162825 [100%]
NBPF10 - ENSG00000163386 [100%]
NBPF9 - ENSG00000168614 [100%]
NBPF12 - ENSG00000186275 [84%]
NBPF16 - ENSG00000203827 [100%]
NBPF20 - ENSG00000203832 [100%]
NBPF1 - ENSG00000219481 [92%]
NBPF15 - ENSG00000243452 [100%]
 NBPF14 - ENSG00000122497 [97%]
NBPF3 - ENSG00000142794 [86%]
NBPF11 - ENSG00000152042 [100%]
NBPF8 - ENSG00000162825 [100%]
NBPF10 - ENSG00000163386 [100%]
NBPF9 - ENSG00000168614 [100%]
NBPF12 - ENSG00000186275 [97%]
NBPF16 - ENSG00000203827 [100%]
NBPF20 - ENSG00000203832 [100%]
NBPF1 - ENSG00000219481 [97%]
NBPF15 - ENSG00000243452 [100%]
 NBPF14 - ENSG00000122497 [97%]
NBPF3 - ENSG00000142794 [90%]
NBPF11 - ENSG00000152042 [97%]
NBPF8 - ENSG00000162825 [100%]
NBPF10 - ENSG00000163386 [100%]
NBPF9 - ENSG00000168614 [93%]
NBPF12 - ENSG00000186275 [97%]
NBPF16 - ENSG00000203827 [97%]
NBPF20 - ENSG00000203832 [100%]
NBPF1 - ENSG00000219481 [93%]
NBPF15 - ENSG00000243452 [97%]
 NBPF3 - ENSG00000142794 [84%]
NBPF11 - ENSG00000152042 [96%]
NBPF8 - ENSG00000162825 [96%]
NBPF10 - ENSG00000163386 [100%]
NBPF9 - ENSG00000168614 [100%]
NBPF6 - ENSG00000186086 [84%]
NBPF12 - ENSG00000186275 [100%]
NBPF4 - ENSG00000196427 [84%]
NBPF16 - ENSG00000203827 [100%]
NBPF20 - ENSG00000203832 [96%]
NBPF1 - ENSG00000219481 [96%]
NBPF15 - ENSG00000243452 [100%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

       

Description

Immunohistochemical staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human stomach, lower shows moderate cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human uterus, post-menopause shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
More information
 Immunohistochemical staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferous ducts.
More information
 Immunohistochemical staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferous ducts.
More information
 Immunohistochemical staining of human testis shows strong dot like positivity in subset of cells in seminiferus ducts.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:500 1:50 1:1300 1:300 1:500 1:35 1:150 

Literature conformity

Partly consistent with gene/protein characterization data No avaliable characterization data No avaliable characterization data No avaliable characterization data No avaliable characterization data No avaliable characterization data No avaliable characterization data 

RNA consistency

Not done Not done Not done Not done Not done Not done Not at all consistent with RNAseq data 

         Western Blot

Image

       

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

529, 407.5, 384.6, 130.6, 105.3, 99.4, 96.6, 96.5, 96.4, 90.4, 90.2, 87.4, 79.2, 68.4, 68.2, 61.5, 29.9 90.4, 90.2, 87.4, 79.2, 61.5 529, 435.3, 407.5, 384.6, 130.6, 106.6, 106.4, 105.9, 105.3, 99.4, 96.4, 90.4, 90.2, 87.4, 79.2, 78.5, 77.7, 77.6, 77.5, 73, 70, 69.7, 68.4, 68.2, 67.1, 66.5, 65.1, 64.4, 61.5, 58.6, 57.6, 38.5 529, 435.3, 407.5, 384.6, 130.6, 106.6, 106.4, 105.9, 105.3, 99.4, 96.6, 96.5, 96.4, 90.4, 90.2, 87.4, 79.2, 78.5, 77.7, 77.6, 77.5, 69.7, 66.5, 58.6, 57.6, 42.4, 28.6, 27.9, 24.2 529, 435.3, 407.5, 130.6, 106.6, 106.4, 105.9, 105.3, 99.4, 96.5, 96.4, 90.4, 90.2, 87.4, 79.2, 78.5, 77.7, 77.6, 77.5, 73, 70, 69.7, 67.1, 66.5, 65.1, 64.4, 58.6, 57.6, 42.4, 24.2 529, 435.3, 407.5, 384.6, 130.6, 106.6, 106.4, 105.9, 105.3, 99.4, 96.6, 96.5, 96.4, 90.4, 90.2, 87.4, 79.2, 78.5, 77.7, 77.6, 77.5, 73, 71.6, 70, 69.7, 67.1, 66.5, 65.1, 64.4, 58.6, 57.6, 42.4, 30.8, 28.6, 27.9, 24.2, 11.1, 9, 8.9 529, 435.3, 407.5, 384.6, 130.6, 105.3, 99.4, 96.6, 96.5, 96.4, 90.4, 90.2, 87.4, 79.2, 78.5, 77.7, 77.6, 77.5, 75.4, 73, 72.2, 72.1, 71.6, 70, 69.7, 68.4, 68.2, 67.1, 66.5, 64.8, 64.4, 61.5, 57.6, 38.5, 34.1, 33.8, 29.9, 14.3, 8.3, 7.3 

Antibody dilution

1:250 1:250 1:250 1:250 1:250 1:130 1:190 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: No bands detected 

         Protein array

Image

       

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:12000 1:3000 1:6000 1:3000 1:3000 1:1050 1:2300 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
NBPF24-001
 
NBPF24-002
 
NBPF24-003
 
NBPF24-008