|
Antibody HPA004179
|
|
Antibody HPA007235
|
|
Antibody HPA008855
|
|
Antibody CAB000036
|
|
Antibody CAB001986
|
|
ANTIBODY INFORMATION
|
|
Provider |
Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| | DakoCytomation
| | Upstate
| |
Product name |
HPA004179 | | HPA007235 | | HPA008855 | | M0613 | | 05-653 | |
Host species |
Rabbit | | Rabbit | | Rabbit | | Mouse | | Mouse | |
Clonality |
pAb | | pAb | | pAb | | mAb | | mAb | |
Purity |
Affinity purified using the PrEST-antigen as affinity ligand | | Affinity purified using the PrEST-antigen as affinity ligand | | Affinity purified using the PrEST-antigen as affinity ligand | | Supernatant | | Not known | |
Released in version |
4 | | 4 | | 4 | | 1 | | 1 | |
ANTIGEN INFORMATION
|
|
Antigen |
Recombinant protein fragment | | Recombinant protein fragment | | Recombinant protein fragment | | Native protein | | Not known | |
Length (aa) |
94 | | 127 | | 74 | | | | | |
Antigen sequence |
ASSTPGGEKETSATQRSSVPSSTEKNAVSMTSSVLSSHSPGSGSSTTQGQ
DVTLAPATEPASGSAATWGQDVTSVPVTRPALGSTTPPAHGVTS
| | TPGGEKETSATQRSSVPSSTEKNAFNSSLEDPSTDYYQELQRDISEMFLQ
IYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAA
SRYNLTISDVSVSDVPFPFSAQSGAGV
| | AVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEK
VSAGNGGSSLSYTNPAVAATSANL
| |
| |
| |
Matching transcripts |
MUC1-001 - ENSP00000357380 [99%]
| | MUC1-002 - ENSP00000357377 [100%] MUC1-014 - ENSP00000357375 [100%] MUC1-202 - ENSP00000388172 [100%] MUC1-007 - ENSP00000338983 [88%] MUC1-003 - ENSP00000389098 [80%]
| | MUC1-001 - ENSP00000357380 [100%] MUC1-002 - ENSP00000357377 [100%] MUC1-003 - ENSP00000389098 [100%] MUC1-005 - ENSP00000357374 [100%] MUC1-006 - ENSP00000357381 [100%] MUC1-007 - ENSP00000338983 [100%] MUC1-008 - ENSP00000339690 [100%] MUC1-009 - ENSP00000342814 [100%] MUC1-013 - ENSP00000357383 [100%] MUC1-014 - ENSP00000357375 [100%] MUC1-201 - ENSP00000343482 [100%]
| | | | | |
Other gene match |
| | | | | | | | | |
ANTIBODY VALIDATION
|
|
Immunohistochemistry
|
|
Image |
| | | | | | | | | |
Description |
Immunohistochemical staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells. More information | | Immunohistochemical staining of human stomach shows strong cytoplasmic and nuclear positivity in glandular cells. More information | | Immunohistochemical staining of human colon shows strong luminal membranous positivity in glandular cells. More information | | Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells. More information | | Immunohistochemical staining of human stomach shows strong membranous positivity in glandular cells. More information | |
Retrieval method |
HIER pH6 | | HIER pH6 | | HIER pH6 | | HIER pH9 | | HIER pH6 | |
Antibody dilution |
1:100 | | 1:200 | | 1:75 | | 1:500 | | 1:300 | |
Literature conformity |
Partly consistent with extensive gene/protein characterization data | | Partly consistent with extensive gene/protein characterization data | | Partly consistent with extensive gene/protein characterization data | | Partly consistent with extensive gene/protein characterization data | | Partly consistent with extensive gene/protein characterization data | |
RNA consistency |
Not done | | Not done | | Not done | | Not done | | Not done | |
Immunofluorescence
|
|
Image |
| | | | | | | | | |
Description |
Application not done for this antibody. | | Application not done for this antibody. | | Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane. More information | | Immunofluorescent staining of human cell line U-2 OS shows positivity in vesicles. More information | | Immunofluorescent staining of human cell line U-2 OS shows positivity in vesicles. More information | |
Antibody dilution |
| | | | 1:27 | | 1:400 | | 1:286 | |
Validation IF |
| | | | Uncertain: The subcellular location is partly supported by literature or no literature is available. | | Supportive: The subcellular location is supported by literature. | | Supportive: The subcellular location is supported by literature. | |
Western Blot
|
|
Image |
| | | | | | | | | |
Description |
Lane 1: Marker [kDa] 229, 112, 83.5, 47.9, 32.3, 26.5, 17.2 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Negative control (vector only transfected HEK293T lysate) Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400880) More information | | Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | |
Target mass (kDa) |
49.2 | | 29.6, 28.4, 28.3, 27.6, 24.4 | | 49.2, 29.6, 28.4, 27.6, 24.6, 24.4, 23.7, 21.6, 18.3, 17.3, 17.1 | | 49.2, 29.6, 28.4, 28.3, 27.6, 24.6, 24.4, 23.7, 21.7, 21.6, 18.3, 17.3, 17.1 | | 49.2, 29.6, 28.4, 28.3, 27.6, 24.6, 24.4, 23.7, 21.7, 21.6, 18.3, 17.3, 17.1 | |
Antibody dilution |
1:250 | | 1:250 | | 1:250 | | 1:500 | | 1:500 | |
Validation WB |
Supportive: Band of predicted size in kDa (+/-20%) with additional bands present | | Uncertain: No bands detected | | Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data | | Uncertain: No bands detected | | Supportive: Single band corresponding to the predicted size in kDa (+/-20%) | |
Protein array
|
|
Image |
| | | | | | | | | |
Description |
Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Application not done for this antibody. | | Application not done for this antibody. | |
Antibody dilution |
1:3000 | | 1:3000 | | 1:500 | | | | | |
Validation PA |
Supportive: Pass with single peak corresponding to interaction only with its own antigen. | | Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). | | Supportive: Pass with single peak corresponding to interaction only with its own antigen. | | | | | |
|